High Quality Floating Fish Feed Pellet for Catfish

Original
price: Negotiable
minimum:
Total supply:
Delivery term: The date of payment from buyers deliver within days
seat: Beijing
Validity to: Long-term effective
Last update: 2017-07-15 15:04
Browse the number: 109
inquiry
Company Profile
 
 
Product details
Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitativeandqualitative"andaccordingtotheweather,watertemperature,waterqualityandfeedingadjustfeedingamount,avoidfeedcausestoomuchwaste.Watertemperatureduring20cto30c:3-4times/day;below20c:1-2times/day;Feedrate:3-5%fishweightforstart;1-2%fishweightforgrower;3.Cleartheleftfeedintimetoavoidpollutionwater.Specification;
protein :28% Min
Moisture; 10% Max
Ash: 12% Max
Fat: 4% Min
Size; 1mm---8mm
Storage
Stored in a cool, ventilated and dry place
Shelf life: 12 month
Shipping Information:
  • FOB Port: qingdao
  • Lead Time: 15 - 20 days
  • Dimensions per Unit: 0.8 × 0.5 × 0.8 Meters
  • Weight per Unit: 25.1 Kilograms
  • Units per Export Carton: 15
  • Export Carton Dimensions L/W/H: 5.8 × 2.3 × 2.3 Meters
  • Export Carton Weight: 15 Tons (US)
Main Export Markets:
  • Asia
  • Australasia
  • Central/South America
  • Eastern Europe
  • Mid East/Africa
  • North America
  • Western Europe
Total0bar [View All]  Related Comments
 
more»Other products

[ Products search ] [ favorites ] [ Tell friends ] [ Print ] [ Close ]